PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00053.1.g00530.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 667aa    MW: 73028.9 Da    PI: 7.7497
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00053.1.g00530.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.72.9e-09315373563
                                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                   kr +r   NR +A rs +R+  +i+eLe+kv+ L++e ++L  +l  l+  ++ l +++
  Zjn_sc00053.1.g00530.1.am.mk 315 KRVKRVLANRQSAARSKERRMRYIAELEQKVQILQTEATTLSAQLTLLQRDSSGLATQN 373
                                   999******************************************99998887776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.7E-16311375IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.714313376IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.19E-10315365No hitNo description
PfamPF001706.7E-9315373IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.1E-10315372No hitNo description
CDDcd147032.11E-23316365No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 667 aa     Download sequence    Send to blast
LNRVERPSER YDHTSTPQRH RHRHRCRIKP SIITQARVAH ARHATVPSSD MNGAANGHGM  60
VHHHLHHHAQ ASAPLPTAFP LPAQHHQQQQ QGAGGGSKQR PGLPPTPPGF HAVHADVCMD  120
DSAARAQVLQ GGGLPPRKAH RRSRSDVPFG YLPPPSPTTE AGGGGWCLPG AGGDDLFNAY  180
VTSMEGVDAG GLKYCSDGES RGSSMRTNGA DSSENESEDY GGADSQFLVW GDGAGKKRES  240
VKRNAAGEPA AAPAAGRHTR SLSMDSLMGK LSFSANGEPA GKFSLEFGGG EFTPAEMKRI  300
MADEKLAEMA LADPKRVKRV LANRQSAARS KERRMRYIAE LEQKVQILQT EATTLSAQLT  360
LLQRDSSGLA TQNNELKFRL QAMEQQAQLR DALNEALSAE VQRLKVGDAN SSSNLPQQMQ  420
LHYQSQMHEL HKQQQGEQIP FYQLEQREQN GRPTGTAVCW WQCDALDGEK WQSEREGLGR  480
NTGTATEHGF DVANRVATRE RVVLPIRELM DAPTLAMSVR ATCAMPAWAR DRVLFVVFMH  540
GTPNGLGHIP APRRAALRAP WCWISCPTTI SPVEQQRGER GYRTTLCRSR NRIKICSVPP  600
VKTTSTRSGL LGHHSVLLWA MGFDDELEGE EVESVASKEL TEDCYGDNSC SETANEDDML  660
LLIPTCC
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0352291e-179BT035229.1 Zea mays full-length cDNA clone ZM_BFb0046N14 mRNA, complete cds.
GenBankJX4699261e-179JX469926.1 Zea mays subsp. mays clone UT3184 bZIP-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012698006.11e-174PREDICTED: transcription factor RF2b-like
TrEMBLA0A0E0MA281e-169A0A0E0MA28_ORYPU; Uncharacterized protein
STRINGSi039566m1e-163(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.35e-67bZIP family protein